| request information: | |
| name: | Anti-ARID1A antibody produced in rabbit |
| cat_no: | HPA005456 |
| gene id: | human ARID1A(8289) |
| brand: | SIGMA |
| prod_type: | Chemical |
| name_suffix: | Prestige Antibodies(TM) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution |
| storage temp.: | -20C |
| storage: | -20C |
| form: | buffered aqueous glycerol solution |
| physical form: | Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide |
| antibody form: | affinity isolated antibody |
| shipped in: | wet ice |
| species reactivity: | human |
| application(s): | immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; protein array: suitable |
| immunogen: | AT-rich interactive domain-containing protein 1A recombinant protein epitope signature tag (PrEST); Immunogen sequence: PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFS TQGTPSGSPFPSQQTTMYQQQQQNYK |
| unspsc_code: | 12352203 |
| legal information: | Prestige Antibodies is a trademark of Sigma-Aldrich Biotechnology LP and Sigma-Aldrich Co. |
| grade: | Prestige Antibodies(TM) Powered by Atlas Antibodies |
| application: | Prestige Antibodies(TM) Powered by Atlas Antibodies are developed and validated by the Human Proteome Resource (HPR) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using protein array and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige. |
order or more information: | company product webpage |