ExactAntigen

Anti-CDH1 antibody produced in rabbit | Sigma-Aldrich antibody product information
request information:
name:Anti-CDH1 antibody produced in rabbit
cat_no:HPA004812
gene id:human CDH1(999)
brand:SIGMA
prod_type:Chemical
name_suffix:Prestige Antibodies(TM) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
storage temp.:-20C
storage:-20C
form:buffered aqueous glycerol solution
physical form:Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
antibody form:affinity isolated antibody
shipped in:wet ice
species reactivity:human
application(s):immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; protein array: suitable
immunogen:Epithelial-cadherin precursor recombinant protein epitope signature tag (PrEST); Immunogen sequence:
ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDP
TQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGA
unspsc_code:12352203
legal information:Prestige Antibodies is a trademark of Sigma-Aldrich Biotechnology LP and Sigma-Aldrich Co.
grade:Prestige Antibodies(TM) Powered by Atlas Antibodies
application:Prestige Antibodies(TM) Powered by Atlas Antibodies are developed and validated by the Human Proteome Resource (HPR) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using protein array and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
order or
more information
:
company product webpage
Also see:
all human CDH1 antibodies


2008©ExactAntigen home | browse | about