ExactAntigen

Mouse Monoclonal anti-Rb2 p130 (130P215)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:NB600-1541
ProductName:Rb2 p130 Antibody
Product Description:Mouse Monoclonal anti-Rb2 p130 (130P215)
Clone:130P215
Clonality:Monoclonal
Immunogen:Synthetic peptide: QCPELMMDRHLDQLLMCAIYVMAKVTKEDKSFQNIM, corresponding to amino acids 878-913 of Human p130.
CrossReactivity:Cross-reacts with Human and Rat.Expected to cross-react with Mouse (94% identity with immunogen) due to sequence homology.Not yet tested in other species.
Packaging:0.5 ml Mouse ascites.
Uses:IHC-P: 1/25 - 1/50. An incubation period of 30 minutes at room temperature is recommended. Formalin fixed paraffin embedded tissue sections require high temperature antigen unmasking with 10 mM citrate buffer, pH 6.0 prior to immunostaining.
Localization:Nuclear
Control:Tonsil
Background:Two retinoblastoma related proteins, p107 and pRb2 / p130, which are structurally and functionally similar to the product of the retinoblastoma gene (pRb / p105), were cloned by taking advantage of their ability to bind transforming proteins of DNA tumor viruses through a particular region called the "pocket domain." Like pRb, both proteins play a fundamental role in growth control. These Rb family proteins were measured in a variety of lung neoplasms. The highest percentage of undetectable levels and the tightest inverse correlation with the histological grading and with PCNA expression in the most aggressive tumor types were found for pRb2 / p130, which may suggest an important role for this protein in the pathogenesis and progression of lung cancer.
Storage:Store at 4C. Do not freeze.
Purity:Ascites
Isotype:IgG1
Host_Name:Mouse
ListPrice:325
AppSummary:IHC-P
SpeciesSummary:Hu, Rt
ALTnames:anti-130 kDa retinoblastoma associated protein antibody, anti-130 kDa retinoblastoma-associated protein antibody, anti-FLJ26459 antibody, anti-p130 antibody, anti-PRB 2 antibody, anti-PRB2 antibody, anti-Rb 2 antibody, anti-Rb2 antibody, anti-RBL 2 antibody, anti-RBL2 antibody, anti-RBR 2 antibody, anti-RBR2 antibody, anti-Retinoblastoma like 2 antibody, anti-Retinoblastoma like protein 2 antibody, anti-Retinoblastoma related gene antibody
ProteinTarget:Rb2 p130
PackageSize:0.5 ml
GeneralRef:General / background references:Howard CM et al. Retinoblastoma-related protein pRb2/p130 and suppression of tumor growth in vivo. J Natl Cancer Inst 90:1451-60 (1998). Baldi A et al. Differential expression of the retinoblastoma gene family members pRb/p105, p107, and pRb2/p130 in lung cancer. Clin Cancer Res 2:1239-45 (1996).
see all mouse Rbl2 antibodies
see all human RBL2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about