ExactAntigen

Rabbit Polyclonal anti-E2F1
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:NB300-701
ProductName:E2F1 Antibody
Product Description:Rabbit Polyclonal anti-E2F1
Clonality:Polyclonal
Immunogen:Synthetic peptide: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD, corresponding to amino acids 58-93 of Human E2F1.
Specificity:The antibody does not cross reacts with other proteins of the E2F family members.
CrossReactivity:Cross-reacts with Human. Not yet tested in other species.
Packaging:0.1 mg
Uses:IHC: Use at an assay dependent dilution. IP: Use at an assay dependent dilution. WB: Use at a dilution of 1/1000. Detects a band of approximately 53 kDa. Not tested in other applications.Optimal dilutions/concentrations should be determined by the end user.
Localization:Nuclear
Storage:Store at 4C short term.  Aliquot and store at -20C long term.  Avoid freeze thaw cycles.
Purity:Immunogen affinity purified
Isotype:IgG
Host_Name:Rabbit
ListPrice:325
AppSummary:IHC, IP, WB
SpeciesSummary:Hu
ProteinTarget:E2F1 antibody
PackageSize:0.1 mg
GeneralRef:General / background references:Iglesias A et al. Diabetes and exocrine pancreatic insufficiency in E2F1/E2F2 double-mutant mice. J Clin Invest 113:1398-407 (2004). Powers JT et al. E2F1 uses the ATM signaling pathway to induce p53 and Chk2 phosphorylation and apoptosis. Mol Cancer Res 2:203-14 (2004). Deschênes C et al. The nucleocytoplasmic shuttling of E2F4 is involved in the regulation of human intestinal epithelial cell proliferation and differentiation. J Cell Physiol 199:262-73 (2004).
see all human E2F1 antibodies
see anti rabbit secondary antibodies


2008©ExactAntigen home | browse | about