| CatalogCode: | NB300-701 |
| ProductName: | E2F1 Antibody |
| Product Description: | Rabbit Polyclonal anti-E2F1 |
| Clonality: | Polyclonal |
| Immunogen: | Synthetic peptide: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD, corresponding to amino acids 58-93 of Human E2F1. |
| Specificity: | The antibody does not cross reacts with other proteins of the E2F family members. |
| CrossReactivity: | Cross-reacts with Human. Not yet tested in other species. |
| Packaging: | 0.1 mg |
| Uses: | IHC: Use at an assay dependent dilution. IP: Use at an assay dependent dilution. WB: Use at a dilution of 1/1000. Detects a band of approximately 53 kDa. Not tested in other applications.Optimal dilutions/concentrations should be determined by the end user. |
| Localization: | Nuclear |
| Storage: | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze thaw cycles. |
| Purity: | Immunogen affinity purified |
| Isotype: | IgG |
| Host_Name: | Rabbit |
| ListPrice: | 325 |
| AppSummary: | IHC, IP, WB |
| SpeciesSummary: | Hu |
| ProteinTarget: | E2F1 antibody |
| PackageSize: | 0.1 mg |
| GeneralRef: | General / background references:Iglesias A et al. Diabetes and exocrine pancreatic insufficiency in E2F1/E2F2 double-mutant mice. J Clin Invest 113:1398-407 (2004). Powers JT et al. E2F1 uses the ATM signaling pathway to induce p53 and Chk2 phosphorylation and apoptosis. Mol Cancer Res 2:203-14 (2004). Deschênes C et al. The nucleocytoplasmic shuttling of E2F4 is involved in the regulation of human intestinal epithelial cell proliferation and differentiation. J Cell Physiol 199:262-73 (2004). |