| request information: |
|
| Catalog Code: | NB120-19109 |
| Product Name: | Macrophage Inflammatory Protein 1 beta Antibody |
| Product Description: | Chicken Polyclonal anti-Macrophage Inflammatory Protein 1 beta |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Concentration: | 1 mg/ml |
| Immunogen: | Synthetic peptide: GSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN, corresponding to amino acids 27-92 of Human Macrophage Inflammatory Protein 1 beta. |
| Cross Reactivity: | Cross-reacts with Human.Not yet tested in other species. |
| Packaging: | 0.05 mg Immunogen affinity purified Chicken IgY |
| Uses: | ELISA: Use at a concentration of 0.1 - 0.5 ug/ml. WB: Use at an assay dependent dilution. Predicted molecular weight: 10 kDa. Not tested in other applications.Optimal dilutions/concentrations should be determined by the end user. |
| Localization: | Secreted |
| Background: | MIP1 alpha and MIP1 beta were originally co-purified from medium conditioned by an LPS-stimulated murine macrophage cell line. Human MIP1 beta refers to the products of several independently cloned cDNAs, including Act2, PAT 744, hH400, G26, HIMAP, HC21, and MAD 5a. The predicted protein products of these cDNAs represent variants that are between 94% - 98% identical and these proteins are all approximately 75% homologous to murine MIP1 beta. MIP1 beta also shares approximately 70% amino acid identity with MIP1 alpha. MIP1 proteins are expressed primarily in T cells, B cells, and monocytes after antigen or mitogen stimulation. The MIP1 proteins have chemoattractant and adhesive effects on lymphocytes, with MIP1 alpha and MIP1 beta preferentially attracting CD8+ and CD4+ T cells, respectively. A signal transducing receptor designated the CC chemokine receptor 1 (CC CKR1) with seven transmembrane domains that binds MIP1 alpha, MIP1 beta, MCP1 and RANTES with varying affinities has been isolated. |
| Storage: | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze thaw cycles. |
| Purity: | Immunogen affinity purified |
| Isotype: | IgY |
| Host Name: | Chicken |
| Buffer: | PBS |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu, |
| Alternate Names: | anti-ACT2 antibody, anti-CCL4 antibody,anti-ccl4l 1 antibody , anti-CCL4L1 antibody,anti-Chemokine CC Motif Ligand 4 antibody , anti-G 26 T lymphocyte secreted protein antibody, anti-HC21 antibody, anti-lag 1 antibody, anti-LAG1 antibody, anti-Lymphocyte activation gene 1 antibody, anti-MIP1 beta antibody, anti-Small inducible cytokine A4 antibody |
| Package Size: | 0.05 mg |
| Preservative: | None |
| General References: | General / background references:Cocchi F et al. Identification of RANTES, MIP-1 alpha, and MIP-1 beta as the major HIV-suppressive factors produced by CD8+ T cells. Science 270:1811-5 (1995). |
order or
more information: | company product webpage |
|