| CatalogCode: | NB120-17693 |
| ProductName: | IL8 Antibody |
| Product Description: | Chicken Polyclonal anti-IL8 |
| Clonality: | Polyclonal |
| Immunogen: | Synthetic peptide: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS, corresponding to amino acids 28-99 of Human IL8. |
| CrossReactivity: | Cross-reacts with Human.Expected to cross-react with Rabbit (88% identity with immunogen) due to sequence homology.Not yet tested in other species. |
| Packaging: | 0.1 mg Affinity purified Chicken antisera. |
| Uses: | WB: Predicted molecular weight: 11 kDa. Optimal dilutions/concentrations should be determined by the end user. |
| Localization: | Secreted |
| Storage: | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze thaw cycles. |
| Purity: | Affinity purified |
| Isotype: | IgY |
| Host_Name: | Chicken |
| Buffer: | PBS |
| ListPrice: | 375 |
| AppSummary: | ELISA, IHC, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-310C antibody, AMCF 1 antibody, AMCF1 antibody, Beta thromboglobulin like protein antibody, CXC chemokine ligand 8 antibody, CXCL 8 antibody, CXCL8 antibody, Emoctakin antibody, GCP 1 antibody, GCP1 antibody, Granulocyte chemotactic protein 1 antibody, IL 8 antibody, Inteleukin 8 antibody, K 60 antibody, K60 antibody, LECT antibody, LUCT antibody, Lymphocyte derived neutrophil activating factor antibody, LYNAP antibody, MDNCF antibody, MONAP antibody, Monocyte derived neutrophil activating protein antibody, Monocyte derived neutrophil chemotactic factor antibody, NAF antibody, NAP 1 antibody, NAP1 antibody, Neutrophil activating factor antibody, Neutrophil activating peptide 1 antibody, Neutrophil activating protein 1 antibody, Protein 3 10C antibody, SCYB 8 antibody, SCYB8 antibody, T cell chemotactic factor antibody, TSG 1 antibody, TSG1 antibody |
| ProteinTarget: | IL8 |
| PackageSize: | 0.1 mg |
| GeneralRef: | General / background references:Baldwin ET et al. Crystallization of human interleukin-8. A protein chemotactic for neutrophils and T-lymphocytes. J Biol Chem 265:6851-3 (1990). |
|