ExactAntigen

Chicken Polyclonal anti-Cytokeratin 18 | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: NB120-17690
ProductName: Cytokeratin 18 Antibody
Product Description: Chicken Polyclonal anti-Cytokeratin 18
Clonality: Polyclonal
Immunogen: Synthetic peptide: GEDFNLGDALDSSNSMQTIQKTTTRRIVDGKVVSETNDTKVLRH, corresponding to amino acids 386-430 of Human Cytokeratin 18.
CrossReactivity: Cross-reacts with Human, Mouse and Rat.Expected to cross-react with Cat (88% identity with immunogen) due to sequence homology.Not yet tested in other species.
Packaging: 0.1 mg IgG purified Chicken IgY.
Uses: ICC: 1/200. WB: 1/500. Predicted molecular weight: 48 kDa. Not tested in other applications.Optimal dilutions/concentrations should be determined by the end user.
Localization: Cytoplasmic
Background: Cytokeratins (CK) are intermediate filaments of epithelial cells, both in keratinizing tissue (ie., skin) and non keratinizing cells (ie. mesothelial cells). Although not a traditional marker for endothelial cells, cytokeratins have also been found in some microvascular endothelial cells. Atleast 20 different cytokeratins (CK) in the molecular range of 40-70 kDa and isoelectric points of 5-8.5 can be identified using two dimensional gel electrophoresis. Biochemically, most members of the CK family fall into one of two classes, type I (acidic polypeptides) and type II (basic polypeptides). At least one member of the acidic family and one member of the basic family is expressed in all epithelial cells. Monoclonal antibodies to cytokeratin proteins can be useful markers for tumor identification and classification. Cytokeratin 18 is an acidic keratin which is found primarily in non squamous epithelia and is present in a majority of adenocarcinomas and ductal carcinomas but not in squamous cell carcinomas. Cytokeratin 18 exists in combination with Cytokeratin 8, a basic keratin. Hepatocellular carcinomas have been reportedly defined by the use of antibodies that recognize only Cytokeratins 8 and 18.
Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze thaw cycles.
Purity: IgG purified
Isotype: IgY
Host_Name: Chicken
Buffer: PBS
ListPrice: 345
AppSummary: ICC, WB
SpeciesSummary: Hu, Mu, Rt
ALTnames: anti-CK 18 antibody, anti-CYK18 antibody, anti-Cytokeratin endo B antibody, anti-Keratin 18 antibody, anti-Keratin D antibody, anti-Keratin type I cytoskeletal 18 antibody, anti-Kerd antibody, anti-KRT18 antibody
ProteinTarget: Cytokeratin 18
PackageSize: 0.1 mg
GeneralRef: General / background references:Ku NO et al. Keratin 8 and 18 mutations are risk factors for developing liver disease of multiple etiologies. Proc Natl Acad Sci U S A 100:6063-8 (2003).
more information: company product webpage
Also see:
see all human KRT18 antibodies
see anti chicken secondary antibodies


2008©ExactAntigen home | browse | about