ExactAntigen

Chicken Polyclonal anti-CD26
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:NB120-17538
ProductName:CD26 Antibody
Product Description:Chicken Polyclonal anti-CD26
Clonality:Polyclonal
Immunogen:Synthetic peptide: YAGPCSQKADTVFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTFEVEDQIEAA , corresponding to amino acids 547-610 of Human CD26.
CrossReactivity:Cross-reacts with Human, Mouse and Rat. Expected to cross-react with Cow (96% identity with immunogen), Cat (98% identity with immunogen), Chicken (89% identity with immunogen), Dog (93% identity with immunogen) and Pig (93% identity with immunogen) due to sequence homology.Not yet tested in other species.
Packaging:0.05 mg Affinity purified Chicken antisera.
Uses:Immunocytochemistry.
Localization:Type II membrane protein. Also exists in a soluble form.
Background:CD26 [also known as dipeptidyl peptidase IV (DPP IV), adenosine deaminase (ADA) binding protein] is an atypical serine protease belonging to the prolyl oligopeptidase family. It is expressed on lymphocyte cells and is upregulated during T cell activation. CD26 is also expressed on activated B cells and natural killer cells and abundantly on epithelia. CD26 is implicated in a variety of biological functions including T cell activation, cell adhesion with extracellular matrix such as fibronectin or collagens, and in HIV infection
Storage:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze thaw cycles.
Purity:Affinity purified
Isotype:IgY
Host_Name:Chicken
Buffer:Constituents: PBS
ListPrice:295
AppSummary:ICC
SpeciesSummary:Hu, Mu, Rt
ALTnames:anti-ADABP antibody, anti-ADCP2 antibody, anti-Adenosine deaminase complexing protein 2 antibody, anti-Dipeptidyl peptidase iv antibody, anti-Dipeptidylpeptidase 4 antibody, anti-DPP4 antibody, anti-DPPIV antibody, anti-Intestinal dipeptidyl peptidase antibody, anti-T cell activation antigen CD26 antibody, anti-TP103 antibody
ProteinTarget:CD26
PackageSize:0.05 mg
GeneralRef:General / background references:Bernard AM et al. Structure of the mouse dipeptidyl peptidase IV (CD26) gene. Biochemistry 33:15204-14 (1994).
see all human DPP4 antibodies
see all chicken RCJMB04_29 antibodies
see all dog DPP4 antibodies
see anti chicken secondary antibodies


2008©ExactAntigen home | browse | about