| CatalogCode: | NB120-17538 |
| ProductName: | CD26 Antibody |
| Product Description: | Chicken Polyclonal anti-CD26 |
| Clonality: | Polyclonal |
| Immunogen: | Synthetic peptide: YAGPCSQKADTVFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTFEVEDQIEAA , corresponding to amino acids 547-610 of Human CD26. |
| CrossReactivity: | Cross-reacts with Human, Mouse and Rat. Expected to cross-react with Cow (96% identity with immunogen), Cat (98% identity with immunogen), Chicken (89% identity with immunogen), Dog (93% identity with immunogen) and Pig (93% identity with immunogen) due to sequence homology.Not yet tested in other species. |
| Packaging: | 0.05 mg Affinity purified Chicken antisera. |
| Uses: | Immunocytochemistry. |
| Localization: | Type II membrane protein. Also exists in a soluble form. |
| Background: | CD26 [also known as dipeptidyl peptidase IV (DPP IV), adenosine deaminase (ADA) binding protein] is an atypical serine protease belonging to the prolyl oligopeptidase family. It is expressed on lymphocyte cells and is upregulated during T cell activation. CD26 is also expressed on activated B cells and natural killer cells and abundantly on epithelia. CD26 is implicated in a variety of biological functions including T cell activation, cell adhesion with extracellular matrix such as fibronectin or collagens, and in HIV infection |
| Storage: | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze thaw cycles. |
| Purity: | Affinity purified |
| Isotype: | IgY |
| Host_Name: | Chicken |
| Buffer: | Constituents: PBS |
| ListPrice: | 295 |
| AppSummary: | ICC |
| SpeciesSummary: | Hu, Mu, Rt |
| ALTnames: | anti-ADABP antibody, anti-ADCP2 antibody, anti-Adenosine deaminase complexing protein 2 antibody, anti-Dipeptidyl peptidase iv antibody, anti-Dipeptidylpeptidase 4 antibody, anti-DPP4 antibody, anti-DPPIV antibody, anti-Intestinal dipeptidyl peptidase antibody, anti-T cell activation antigen CD26 antibody, anti-TP103 antibody |
| ProteinTarget: | CD26 |
| PackageSize: | 0.05 mg |
| GeneralRef: | General / background references:Bernard AM et al. Structure of the mouse dipeptidyl peptidase IV (CD26) gene. Biochemistry 33:15204-14 (1994). |