| CatalogCode: | NB120-14313 |
| ProductName: | PRKCQ Antibody |
| Product Description: | Chicken Polyclonal anti-PRKCQ |
| Clonality: | Polyclonal |
| Immunogen: | Synthetic peptide: LVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPFDCSNFDKEFLNEKP, corresponding to amino acids 610-673 of Human PRKCQ. |
| CrossReactivity: | Cross-reacts with Human and Mouse.Expected to cross-react with Rat (89% identity with immunogen) due to sequence homology.Not yet tested in other species. |
| Packaging: | 0.05 mg Immunogen affinity purified Chicken IgY |
| Uses: | ICC: Use at a dilution of 1/200. IHC: Use at a dilution of 1/200. WB: Use at a dilution of 1/500. Predicted molecular weight: 82 kDa. Not tested in other applications.Optimal dilutions/concentrations should be determined by the end user. |
| Background: | PRKCQ is a calcium-independent, novel isoform that is important in transducing signals in T lymphocytes. Interaction of a T lymphocyte with an antigen-presenting cell results in clustering of the T cell antigen receptor (TCR) and the recruitment of a large signaling complex to the site of cell-cell contact. PRKCQ is essential for TCR-mediated activation. PKC theta plays a role in pathways that link the TCR signaling complex to the activation of NF-kappa B in mature T lymphocytes. |
| Storage: | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze thaw cycles. |
| Purity: | Immunogen affinity purified |
| Isotype: | IgY |
| Host_Name: | Chicken |
| Buffer: | PBS |
| ListPrice: | 285 |
| AppSummary: | ICC, IHC, WB |
| SpeciesSummary: | Hu, Mu |
| ALTnames: | anti-nPKC-theta antibody, anti-PRKCT antibody, anti-Protein kinase C theta antibody, anti-Protein kinase C theta type antibody |
| ProteinTarget: | PRKCQ |
| PackageSize: | 0.05 mg |
| GeneralRef: | General / background references:Sun Z et al. PKC-theta is required for TCR-induced NF-kappaB activation in mature but not immature T lymphocytes. Nature 404:402-7 (2000). |
order or
more information: | company product webpage |
| request information: |
|