| request information: |
|
| Catalog Code: | NB120-14234 |
| Product Name: | Calreticulin Antibody |
| Product Description: | Chicken Polyclonal anti-Calreticulin |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Concentration: | 1 mg/ml |
| Immunogen: | Synthetic peptide: AEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL, corresponding to amino acids 353-416 of Human Calreticulin. |
| Cross Reactivity: | Cross-reacts with Human, Mouse, Rat, Cow, Rabbit, and a wide range of other species. Not yet tested in other species. |
| Packaging: | 0.05 mg Immunogen affinity purified Chicken antisera. |
| Localization: | Endoplasmic reticulum |
| Storage: | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze thaw cycles. |
| Purity: | Immunogen affinity purified |
| Isotype: | IgY |
| Host Name: | Chicken |
| Buffer: | PBS |
| Application Summary: | immunohistochemistry 1:200, immunofluorescence 1:200, Western Blot 1:1000, Immunocytochemistry 1:200 |
| Species Summary: | Bv, Hu, Mu, Rt, Rb, |
| Alternate Names: | anti-Autoantigen RO antibody, anti-CALR antibody, anti-CALR protein antibody, anti-Calregulin antibody, anti-Calreticulin antibody, anti-cC1qR antibody, anti-CRP55 antibody, anti-CRTC antibody, anti-ERp60 antibody, anti-FLJ26680 antibody, anti-grp60 antibody, anti-HACBP antibody, anti-SSA antibody |
| Package Size: | 0.05 mg |
| Preservative: | No Preservative |
| General References: | General / background references:Coppolino MG & Dedhar S Calreticulin. Int J Biochem Cell Biol 30:553-8 (1998). |
order or
more information: | company product webpage |
|