ExactAntigen

VEGF Receptor 2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:NB120-14079
Product Type:Primary Antibody
Product Name:VEGF Receptor 2 Antibody
List Price:330
Clonality:Polyclonal
Gene ID:3791
Host:Chicken
Isotype:IgY
Product Description:Chicken Polyclonal anti-VEGF Receptor 2
Cross Reactivity:Cross-reacts with Human.Not yet tested in other species.
Alternate Names:anti-CD309 antigen antibody, anti-Fetal liver kinase 1 antibody, anti-FLK1 antibody, anti-KDR antibody, anti-Kinase insert domain receptor antibody, anti-KRD1 antibody, anti-Ly73 antibody, anti-Protein tyrosine kinase receptor FLK1 antibody, anti-Vascular
Immunogen:Synthetic peptide: ITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQ, corresponding to amino acids 53-120 of VEGF Receptor 2.
Localization:Type I membrane protein
Purity:Immunogen affinity purified
Buffer:Preservative: NoneConstituents: PBS
Packaging:50 micrograms
Package Size:0.05 mg
Concentration:1 mg/ml
Uses:ICC: Use at a dilution of 1/200. IHC: Use at a dilution of 1/200. WB: Use at an assay dependent dilution. Detects a band of approximately 65 kDa. Not tested in other applications.Optimal dilutions/concentrations should be determined by the end user.
Application Summary:ICC, IHC, WB
see all human KDR antibodies
see anti chicken secondary antibodies


2008©ExactAntigen home | browse | about