| Catalog Code: | NB120-14079 |
| Product Type: | Primary Antibody |
| Product Name: | VEGF Receptor 2 Antibody |
| List Price: | 330 |
| Clonality: | Polyclonal |
| Gene ID: | 3791 |
| Host: | Chicken |
| Isotype: | IgY |
| Product Description: | Chicken Polyclonal anti-VEGF Receptor 2 |
| Cross Reactivity: | Cross-reacts with Human.Not yet tested in other species. |
| Alternate Names: | anti-CD309 antigen antibody, anti-Fetal liver kinase 1 antibody, anti-FLK1 antibody, anti-KDR antibody, anti-Kinase insert domain receptor antibody, anti-KRD1 antibody, anti-Ly73 antibody, anti-Protein tyrosine kinase receptor FLK1 antibody, anti-Vascular |
| Immunogen: | Synthetic peptide: ITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQ, corresponding to amino acids 53-120 of VEGF Receptor 2. |
| Localization: | Type I membrane protein |
| Purity: | Immunogen affinity purified |
| Buffer: | Preservative: NoneConstituents: PBS |
| Packaging: | 50 micrograms |
| Package Size: | 0.05 mg |
| Concentration: | 1 mg/ml |
| Uses: | ICC: Use at a dilution of 1/200. IHC: Use at a dilution of 1/200. WB: Use at an assay dependent dilution. Detects a band of approximately 65 kDa. Not tested in other applications.Optimal dilutions/concentrations should be determined by the end user. |
| Application Summary: | ICC, IHC, WB |
|