ExactAntigen

Chicken Polyclonal anti-RGS6
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:NB120-14070
ProductName:RGS6 Antibody
Product Description:Chicken Polyclonal anti-RGS6
Clonality:Polyclonal
Immunogen:Synthetic peptide: KSVYGVTEESQAQSPVHVLSQPIRKTTKEDIRKQI, corresponding to amino acids 231-265 of Human RGS6.
Epitope:Amino acids 231-265 are a unique region for RGS6
CrossReactivity:Cross-reacts with Human.Not yet tested in other species.
Packaging:0.05 mg Immunogen affinity purified Chicken IgY
Uses:ICC: Use at a dilution of 1/200. IHC: Use at a dilution of 1/200. WB: Use at a dilution of 1/500 - 1/2000. Predicted molecular weight: 57 kDa. Not tested in other applications.Optimal dilutions/concentrations should be determined by the end user.
Localization:Cell Membrane and Cytoplasmic
Background:RGS6 belongs to a subfamily of RGS proteins, which serve as GAPs (GTPase-activating proteins), increasing the rate at which GTP is converted to GDP by isoform alpha G proteins.
Storage:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze thaw cycles.
Purity:Immunogen affinity purified
Isotype:IgY
Host_Name:Chicken
Buffer:PBS
ListPrice:285
AppSummary:ICC, IHC, WB
SpeciesSummary:Hu, Mu, Rt
ALTnames:anti-G protein signaling 6 regulator antibody, anti-GAP antibody, anti-GTPase activating protein antibody, anti-Regulator of G protein signaling 6 antibody, anti-S914 antibody
ProteinTarget:RGS6
PackageSize:0.05 mg
GeneralRef:General / background references:Snow BE et al. Fidelity of G protein beta-subunit association by the G protein gamma-subunit-like domains of RGS6, RGS7, and RGS11. Proc Natl Acad Sci U S A 96:6489-94 (1999).
see all human RGS6 antibodies
see anti chicken secondary antibodies


2008©ExactAntigen home | browse | about