| CatalogCode: | NB120-14070 |
| ProductName: | RGS6 Antibody |
| Product Description: | Chicken Polyclonal anti-RGS6 |
| Clonality: | Polyclonal |
| Immunogen: | Synthetic peptide: KSVYGVTEESQAQSPVHVLSQPIRKTTKEDIRKQI, corresponding to amino acids 231-265 of Human RGS6. |
| Epitope: | Amino acids 231-265 are a unique region for RGS6 |
| CrossReactivity: | Cross-reacts with Human.Not yet tested in other species. |
| Packaging: | 0.05 mg Immunogen affinity purified Chicken IgY |
| Uses: | ICC: Use at a dilution of 1/200. IHC: Use at a dilution of 1/200. WB: Use at a dilution of 1/500 - 1/2000. Predicted molecular weight: 57 kDa. Not tested in other applications.Optimal dilutions/concentrations should be determined by the end user. |
| Localization: | Cell Membrane and Cytoplasmic |
| Background: | RGS6 belongs to a subfamily of RGS proteins, which serve as GAPs (GTPase-activating proteins), increasing the rate at which GTP is converted to GDP by isoform alpha G proteins. |
| Storage: | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze thaw cycles. |
| Purity: | Immunogen affinity purified |
| Isotype: | IgY |
| Host_Name: | Chicken |
| Buffer: | PBS |
| ListPrice: | 285 |
| AppSummary: | ICC, IHC, WB |
| SpeciesSummary: | Hu, Mu, Rt |
| ALTnames: | anti-G protein signaling 6 regulator antibody, anti-GAP antibody, anti-GTPase activating protein antibody, anti-Regulator of G protein signaling 6 antibody, anti-S914 antibody |
| ProteinTarget: | RGS6 |
| PackageSize: | 0.05 mg |
| GeneralRef: | General / background references:Snow BE et al. Fidelity of G protein beta-subunit association by the G protein gamma-subunit-like domains of RGS6, RGS7, and RGS11. Proc Natl Acad Sci U S A 96:6489-94 (1999). |