| request information: |
|
| Catalog Code: | NB120-14043 |
| Product Name: | IP10 Antibody |
| Product Description: | Chicken Polyclonal anti-IP10 |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Concentration: | 1 mg/ml |
| Immunogen: | Synthetic peptide: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP , corresponding to amino acids 22-98 of Human IP10. |
| Cross Reactivity: | Cross-reacts with Human.Not yet tested in other species. |
| Packaging: | 0.05 mg Immunogen affinity purified Chicken IgY. |
| Uses: | ELISA: Use at a concentration of 0.4 ug/ml. IHC: Use at an assay dependent dilution. WB: Use at an assay dependent dilution. Predicted molecular weight: 11 kDa. Not tested in other applications.Optimal dilutions/concentrations should be determined by the end user. |
| Localization: | Secreted |
| Background: | Interferon-gamma-inducible 10 kD protein (IP-10), is a CXC chemokine with chemoattractant properties for CD4-positive T cells and inhibits early normal and leukemic hemopoietic progenitor proliferation. IP-10 is produced by a wide variety of cell types ranging from neutrophils and monocytes to hepatocytes, endothelial cells and keratinocytes. The cytokine is reported to be involved in a scala of inflammatory pathologies such as HIV encephalitis, cutaneous T cell lymphoma, chronic hepatitis and acute anterior uveitis. Various observations strongly suggest a role for the CXC chemokines IL-8 and IP-10 in the regulation of angiogenic activity in cancer and in idiopathic pulmonary fibrosis. |
| Storage: | 4 degree C for short term (weeks) and -20 degree C for long term. Avoid frequent freeze and thaw. |
| Purity: | Immunogen affinity purified |
| Isotype: | IgY |
| Host Name: | Chicken |
| Buffer: | PBS |
| Application Summary: | ELISA, immunohistochemistry, Western Blot |
| Species Summary: | Hu, |
| Alternate Names: | anti-10 kDa interferon gamma induced protein antibody, anti-C7 antibody, anti-Chemokine (C X C motif) ligand 10 antibody, anti-Chemokine CXC motif ligand 10 antibody, anti-Crg 2 antibody, anti-CRG2 antibody, anti-CXCL 10 antibody, anti-CXCL10 antibody, anti-Gamma IP10 antibody, anti-gIP 10 antibody, anti-GIP10 antibody, anti-IFI 10 antibody, anti-IFI10 antibody, anti-INP 10 antibody, anti-INP10 antibody,anti-Interferon activated gene 10 antibody , anti-Interferon gamma induced cell line antibody, anti-Interferon inducible cytokine IP 10 antibody, anti-Interferon inducible cytokine IP10 antibody, anti-IP 10 antibody, anti-Mob 1 antibody, anti-MOB1 antibody, anti-SCYB 10 antibody, anti-SCYB10 antibody, anti-Small inducible cytokine B10 antibody, anti-Small inducible cytokine B10 precursor antibody, anti-Small inducible cytokine subfamily B (Cys X Cys) member 10 antibody, anti-Small inducible cytokine subfamily B CXC member 10 antibody |
| Package Size: | 0.05 mg |
| Preservative: | none |
| General References: | General / background references:Luster AD et al. Gamma-interferon transcriptionally regulates an early-response gene containing homology to platelet proteins. Nature 315:672-6 (1985). |
order or
more information: | company product webpage |
|