| CatalogCode: | NB120-14005 |
| ProductName: | CAPZA1 Antibody |
| Product Description: | Chicken Polyclonal anti-CAPZA1 |
| Clonality: | Polyclonal |
| Immunogen: | Synthetic peptide: GDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHYSNGFCTVYAKTIDG , corresponding to amino acids 80-150 of Human CAPZA1. |
| CrossReactivity: | Cross-reacts with Human and Rat.Expected to cross-react with Mouse (95% identity with immunogen) and Chicken (83% identity with immunogen) due to sequence homology.Not yet tested in other species. |
| Packaging: | 0.5 mg |
| Uses: | ICC: Use at a dilution of 1/200. IHC: Use at a dilution of 1/200. WB: Use at a dilution of 1/500 - 1/2000. Predicted molecular weight: 34 kDa. Not tested in other applications.Optimal dilutions/concentrations should be determined by the end user. |
| Purity: | Immunogen affinity purified |
| Isotype: | IgY |
| Host_Name: | Chicken |
| Buffer: | Preservative: NoneConstituents: PBS |
| ListPrice: | 330 |
| AppSummary: | ICC, IHC, WB |
| ALTnames: | anti-CAPPA1 antibody, anti-CAPZ antibody, anti-CAZ1 antibody |
| ProteinTarget: | CAPZA1 |
| PackageSize: | 0.05 mg |
| GeneralRef: | General / background references:Barron-Casella EA et al. Sequence analysis and chromosomal localization of human Cap Z. Conserved residues within the actin-binding domain may link Cap Z to gelsolin/severin and profilin protein families. J Biol Chem 270:21472-9 (1995). |
order or
more information: | company product webpage |
| request information: |
|