| Catalog Code: | NB110-57131 |
| Product Type: | Primary Antibody |
| Product Name: | MRP-1 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 928 |
| Host: | Mouse |
| Clone: | IU5C1 |
| Isotype: | IgG1 |
| Product Description: | Mouse Monoclonal anti-MRP-1 (IU5C1) |
| Cross Reactivity: | This antibody cross-reacts with human and mouse protein. Other species have not been tested. |
| Species Summary: | Hu, Mu |
| Background: | The MRP molecule, an integral membrane glycophosphoprotein belonging to the same superfamily of ATP-binding cassette transmembrane transporter proteins as P-glycoprotein, is overexpressed in many P-glycoprotein-negative, multidrug resistant cell lines and |
| Alternate Names: | anti-ABC29 antibody, ABCC antibody, ABCC1 antibody, ATP binding cassette sub-family C member 1 antibody, GSX antibody, MRP antibody, Multidrug resistance associated protein 1 antibody, Multidrug resistance protein antibody, Multiple drug resistance associ |
| Immunogen: | A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of the human protein. [Swiss-Prot# P33527] |
| Epitope: | Residues 14-19 (PLWDWN) of the human protein. |
| Purity: | Ascites |
| Packaging: | 0.1 ml unpurified Mouse ascites. |
| Package Size: | 0.1 ml |
| Concentration: | 6.8 mg/ml |
| Uses: | This antibody may be used for Western blot analysis on transfected lysate, where a band is seen at ~172 kDa. This antibody may also be useful for immunofluorescence, as reported in literature. |
| Application Summary: | WB, ECL |
| Product References: | 1. Chen, Q, et al. JBC. 281: 31152-31163 (2006) |