ExactAntigen

MRP-1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:NB110-57131
Product Type:Primary Antibody
Product Name:MRP-1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:928
Host:Mouse
Clone:IU5C1
Isotype:IgG1
Product Description:Mouse Monoclonal anti-MRP-1 (IU5C1)
Cross Reactivity:This antibody cross-reacts with human and mouse protein. Other species have not been tested.
Species Summary:Hu, Mu
Background:The MRP molecule, an integral membrane glycophosphoprotein belonging to the same superfamily of ATP-binding cassette transmembrane transporter proteins as P-glycoprotein, is overexpressed in many P-glycoprotein-negative, multidrug resistant cell lines and
Alternate Names:anti-ABC29 antibody, ABCC antibody, ABCC1 antibody, ATP binding cassette sub-family C member 1 antibody, GSX antibody, MRP antibody, Multidrug resistance associated protein 1 antibody, Multidrug resistance protein antibody, Multiple drug resistance associ
Immunogen:A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of the human protein. [Swiss-Prot# P33527]
Epitope:Residues 14-19 (PLWDWN) of the human protein.
Purity:Ascites
Packaging:0.1 ml unpurified Mouse ascites.
Package Size:0.1 ml
Concentration:6.8 mg/ml
Uses:This antibody may be used for Western blot analysis on transfected lysate, where a band is seen at ~172 kDa. This antibody may also be useful for immunofluorescence, as reported in literature.
Application Summary:WB, ECL
Product References:1. Chen, Q, et al. JBC. 281: 31152-31163 (2006)
see all mouse Cd9 antibodies
see all human CD9 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about