| CatalogCode: | NB100-739 |
| ProductName: | IL21 Receptor Antibody |
| Product Description: | Rabbit Polyclonal anti-IL21 Receptor |
| Clonality: | Polyclonal |
| Immunogen: | Synthetic peptide: CVLETRSPNPSILSLTWQDEYEELQDQETF, corresponding to N-term amino acids 35-65 of Mouse IL21 Receptor. |
| CrossReactivity: | Cross-reacts with Mouse. Expected to cross-react with Human and Rat (96% identity with immunogen) due to sequence homology. Not yet tested in other species. |
| Packaging: | 0.05 mg Immunogen affinity purified Rabbit antisera. |
| Uses: | Optimal dilutions/concentrations should be determined by the end user. |
| Localization: | Cell Membrane |
| Control: | Mouse thymus/spleen. |
| Background: | The protein encoded by this gene is a cytokine receptor for interleukin 21 (IL21). It belongs to the type I cytokine receptors, and has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the receptors for interleukin 2 (IL2) and interleukin 5 (IL5). This receptor transduces the growth promoting signal of IL21, and is important for the proliferation and differentiation of T cells, B cells, and natural killer (NK) cells. The ligand binding of this receptor leads to the activation of multiple downstream signaling molecules, including JAK1, JAK3, STAT1, and STAT3. Knockout studies of a similar gene in mouse suggest a role for this gene in regulating immunoglobulin production. Three alternatively spliced transcript variants encoding the same protein have been described. |
| Storage: | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze thaw cycles. |
| Purity: | Immunogen affinity purified |
| Isotype: | IgG |
| Host_Name: | Rabbit |
| Buffer: | PBS [pH 7.2] |
| ListPrice: | 285 |
| AppSummary: | ELISA, IHC |
| SpeciesSummary: | Mu |
| ALTnames: | anti-IL 21R antibody, anti-IL21 Receptor antibody, anti-IL21R antibody, anti-Interleukin 21 receptor antibody, anti-MGC10967 antibody, anti-NILR antibody |
| ProteinTarget: | IL21 (Mouse) Receptor antibody |
| PackageSize: | 0.05 mg |
| GeneralRef: | Ozaki K et al. Cloning of a type I cytokine receptor most related to the IL-2 receptor beta chain. Proc Natl Acad Sci U S A 97:11439-44 (2000). |
order or
more information: | company product webpage |
| request information: |
|