| CatalogCode: | | H00387129-M01 |
| ProductName: | | GPR154 Antibody |
| Product Description: | | Mouse Monoclonal anti-GPR154 (2F5) |
| Clone: | | 2F5 |
| Clonality: | | Monoclonal |
| Immunogen: | | GPR154 (NP_997056, 2 a.a. ~ 54 a.a) partial recombinant protein with GST tag. |
| Epitope: | | PANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQL* ... |
| Specificity: | | GPR154 - G protein-coupled receptor 154 |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | | This gene is a member of the G protein-coupled receptor 1 family and encodes a plasma membrane protein. Increased expression of this gene in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells is associated with asthma. Mutations in this gene have also been associated with this disease. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG1 Kappa |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-GPRA antibody, anti-PGR14 antibody, anti-VRR1 antibody |
| ProteinTarget: | | GPR154 - G protein-coupled receptor 154 |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 387129 |
| Gene_Symbol: | | GPR154 |
| Omim_ID: | | 608584, 608595, |
| more information: | | company product webpage |