ExactAntigen

Mouse Monoclonal anti-GPR154 (2F5) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00387129-M01
ProductName: GPR154 Antibody
Product Description: Mouse Monoclonal anti-GPR154 (2F5)
Clone: 2F5
Clonality: Monoclonal
Immunogen: GPR154 (NP_997056, 2 a.a. ~ 54 a.a) partial recombinant protein with GST tag.
Epitope: PANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQL* ...
Specificity: GPR154 - G protein-coupled receptor 154
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background: This gene is a member of the G protein-coupled receptor 1 family and encodes a plasma membrane protein. Increased expression of this gene in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells is associated with asthma. Mutations in this gene have also been associated with this disease. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG1 Kappa
Host_Name: Mouse
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-GPRA antibody, anti-PGR14 antibody, anti-VRR1 antibody
ProteinTarget: GPR154 - G protein-coupled receptor 154
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 387129
Gene_Symbol: GPR154
Omim_ID: 608584, 608595,
more information: company product webpage
Also see:
see all human NPSR1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about