| Catalog Code: | H00338376-M01 |
| Product Type: | Primary Antibody |
| Product Name: | IFNE1 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 338376 |
| Host: | Mouse |
| Clone: | 3B8 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-IFNE1 (3B8) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours. |
| Alternate Names: | anti-IFNT1 antibody, anti-MGC119018 antibody, anti-MGC119020 antibody, anti-PRO655 antibody |
| Immunogen: | IFNE1 (NP_795372, 109 a.a. ~ 209 a.a) partial recombinant protein with GST tag. |
| Epitope: | FLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | IFNE1 |