ExactAntigen

Mouse Monoclonal anti-PTRF (1F7) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00284119-M02
ProductName: PTRF Antibody
Product Description: Mouse Monoclonal anti-PTRF (1F7)
Clone: 1F7
Clonality: Monoclonal
Immunogen: PTRF (NP_036364, 233 a.a. ~ 322 a.a) partial recombinant protein with GST tag.
Epitope: KKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLVPAERREKLKTSRDKLRKSFTPDHVVYARSKTAVYKVPPF* ...
Specificity: PTRF - polymerase I and transcript release factor
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody reactive against recombinant protein on ELISA.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG2b Kappa
Host_Name: Mouse
ListPrice: 295
AppSummary: ELISA, IHC-P
SpeciesSummary: Hu
ALTnames: anti-FKSG13 antibody
ProteinTarget: PTRF - polymerase I and transcript release factor
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 284119
Gene_Symbol: PTRF
Omim_ID: 603198,
more information: company product webpage
Also see:
see all human PTRF antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about