ExactAntigen

IL27 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00246778-M01
Product Type:Primary Antibody
Product Name:IL27 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:246778
Host:Mouse
Clone:3F12
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-IL27 (3F12)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = IL27 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-IL-27 antibody, anti-IL27p28 antibody, anti-IL30 antibody, anti-MGC71873 antibody, anti-p28 antibody
Immunogen:IL27 (NP_663634, 177 a.a. ~ 244 a.a) partial recombinant protein with GST tag.
Epitope:RKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP* ...
Specificity:IL27 - interleukin 27
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:IL27
Omim ID:608273
see all human IL27 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about