ExactAntigen

Mouse Monoclonal anti-DEPC-1 (2A5-4F5)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00221120-M01
ProductName:DEPC-1 Antibody
Product Description:Mouse Monoclonal anti-DEPC-1 (2A5-4F5)
Clone:2A5-4F5
Clonality:Monoclonal
Immunogen:DEPC-1 (AAH15155, 1 a.a. ~ 140 a.a) full length recombinant protein with GST tag.
Epitope:MEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPDPRGAPW* ...
Specificity:DEPC-1 - prostate cancer antigen-1
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background:The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 (MIM 610602) and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 [PubMed 12486230]).[supplied by OMIM]
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ProteinTarget:DEPC-1 - prostate cancer antigen-1
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:221120
Gene_Symbol:DEPC-1
see all human ALKBH3 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about