ExactAntigen

SPRED2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00200734-M01
Product Type:Primary Antibody
Product Name:SPRED2 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:200734
Host:Mouse
Clone:6G8
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-SPRED2 (6G8)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = SPRED2 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-FLJ21897 antibody, anti-FLJ31917 antibody, anti-Spred-2 antibody
Immunogen:SPRED2 (NP_861449, 120 a.a. ~ 220 a.a) partial recombinant protein with GST tag.
Epitope:EDLIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMPRPCRQVSFPDDDEEIVRINP* ...
Specificity:SPRED2 - sprouty-related, EVH1 domain containing 2
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Product References:Lock P, Stylli SS et al.. Spred-2 steady-state levels are regulated by phosphorylation and Cbl-mediated ubiquitination. Biochem Biophys Res Commun. 2006 Dec 29;351(4):1018-23. Epub 2006 Nov 3.
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:SPRED2
Omim ID:609292,
see all human SPRED2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about