| CatalogCode: | | H00170850-A01 |
| ProductName: | | potassium voltage-gated channel, subfamily G, member 3 Antibody |
| Product Description: | | Mouse Polyclonal anti-potassium voltage-gated channel, subfamily G, member 3 |
| Clonality: | | Polyclonal |
| Immunogen: | | KCNG3 (NP_579875, 23 a.a. ~ 122 a.a) partial recombinant protein with GST tag. |
| Epitope: | | SRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRERNEYFFDRHSEAFGFILLYVRGHGKLRFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRMS* ... |
| Specificity: | | potassium voltage-gated channel, subfamily G, member 3 |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Other applications have not been tested. |
| Background: | | Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This member is a gamma subunit functioning as a modulatory molecule. Alternative splicing results in two transcript variants encoding distinct isoforms. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-KV10.1 antibody, anti-KV6.3 antibody |
| ProteinTarget: | | potassium voltage-gated channel, subfamily G, member 3 |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 170850 |
| Gene_Symbol: | | KCNG3 |
| Omim_ID: | | 606767, |
| more information: | | company product webpage |