ExactAntigen

Mouse Monoclonal anti-ARX (4D12) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00170302-M02
ProductName: ARX Antibody
Product Description: Mouse Monoclonal anti-ARX (4D12)
Clone: 4D12
Clonality: Monoclonal
Immunogen: ARX (NP_620689, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag.
Epitope: MSNQYQEEGCSERPECKSKSPTLLSSYCIDSILGRRSPCKMRLLGAAQSLPAPLTSRADPEKAVQGSPKSSSAPFEAELHLPPKLRRLYGPGGGR* ...
Specificity: ARX - aristaless related homeobox
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody reactive against recombinant protein on ELISA.
Background: This gene is a homeobox-containing gene expressed during development. The expressed protein contains two conserved domains, a C-peptide (or aristaless domain) and the prd-like class homeobox domain. It is a member of the group-II aristaless-related protein family whose members are expressed primarily in the central and/or peripheral nervous system. This gene is thought to be involved in CNS development. Mutations in this gene cause X-linked mental retardation and epilepsy.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG2a Kappa
Host_Name: Mouse
ListPrice: 295
AppSummary: ELISA
SpeciesSummary: Hu
ALTnames: anti-ISSX antibody, anti-MRX36 antibody, anti-MRX54 antibody, anti-MRXS1 antibody, anti-PRTS antibody
ProteinTarget: ARX - aristaless related homeobox
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 170302
Gene_Symbol: ARX
Omim_ID: 300004, 300215, 300382, 300419, 300430, 300432, 308350, 309510,
more information: company product webpage
Also see:
see all human ARX antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about