| CatalogCode: | H00170302-M01 |
| ProductName: | ARX Antibody |
| Product Description: | Mouse Monoclonal anti-ARX (1G2) |
| Clone: | 1G2 |
| Clonality: | Monoclonal |
| Immunogen: | ARX (NP_620689, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag. |
| Epitope: | MSNQYQEEGCSERPECKSKSPTLLSSYCIDSILGRRSPCKMRLLGAAQSLPAPLTSRADPEKAVQGSPKSSSAPFEAELHLPPKLRRLYGPGGGR* ... |
| Specificity: | ARX - aristaless related homeobox |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | This gene is a homeobox-containing gene expressed during development. The expressed protein contains two conserved domains, a C-peptide (or aristaless domain) and the prd-like class homeobox domain. It is a member of the group-II aristaless-related protein family whose members are expressed primarily in the central and/or peripheral nervous system. This gene is thought to be involved in CNS development. Mutations in this gene cause X-linked mental retardation and epilepsy. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-ISSX antibody, anti-MRX36 antibody, anti-MRX54 antibody, anti-MRXS1 antibody, anti-PRTS antibody |
| ProteinTarget: | ARX - aristaless related homeobox |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 170302 |
| Gene_Symbol: | ARX |
| Omim_ID: | 300004, 300215, 300382, 300419, 300430, 300432, 308350, 309510, |