| CatalogCode: | H00151449-M04 |
| ProductName: | GDF7 Antibody |
| Product Description: | Mouse Monoclonal anti-GDF7 (3C2) |
| Clone: | 3C2 |
| Clonality: | Monoclonal |
| Immunogen: | GDF7 (NP_878248, 361 a.a. ~ 451 a.a) partial recombinant protein with GST tag. |
| Epitope: | LGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR* ... |
| Specificity: | GDF7 - growth differentiation factor 7 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Background: | This gene encodes a member of the bone morphogenetic protein (BMP) family. BMPs belong to the transforming growth factor-beta superfamily of secreted signalling molecules that regulate diverse processes in growth, repair and embryonic development. In mouse, this gene functions as an inductive signal from the roof plate required for the specification of neuronal identity in the dorsal spinal cord. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG Mix Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ProteinTarget: | GDF7 - growth differentiation factor 7 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 151449 |
| Gene_Symbol: | GDF7 |
| Omim_ID: | 604651, |
order or
more information: | company product webpage |
| request information: |
|