| CatalogCode: | H00145258-M01 |
| ProductName: | GSC Antibody |
| Product Description: | Mouse Monoclonal anti-GSC (4H7) |
| Clone: | 4H7 |
| Clonality: | Monoclonal |
| Immunogen: | GSC (NP_776248, 151 a.a. ~ 258 a.a) partial recombinant protein with GST tag. |
| Epitope: | LLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSSKASPEKREEEGKSDLDSDS* ... |
| Specificity: | GSC - goosecoid |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. This antibody has also been used in Immunohistochemistry of paraffin embedded sections. |
| Background: | This gene encodes a member of the bicoid subfamily of the paired (PRD) homeobox family of proteins. The encoded protein acts as a transcription factor and may be autoregulatory. A similar protein in mice plays a role in craniofacial and rib cage development during embryogenesis. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG Mix Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB, IHC-P |
| SpeciesSummary: | Hu |
| ProteinTarget: | GSC - goosecoid |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 145258 |
| Gene_Symbol: | GSC |
| Omim_ID: | 138890, |
order or more information: | company product webpage |
| request information: | |