ExactAntigen

WDR36 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00134430-A01
Product Type:Primary Antibody
Product Name:WDR36 Antibody
List Price:205
Clonality:Polyclonal
Gene ID:134430
Host:Mouse
Product Description:Mouse Polyclonal anti-WDR36
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com
Alternate Names:anti-DKFZp686I1650 antibody, anti-TAWDRP antibody
Immunogen:WDR36 (NP_644810, 853 a.a. ~ 952 a.a) partial recombinant protein with GST tag.
Epitope:SGIETELRSLSPDCGGSIEVMQSFLKMIGMMLDRKRDFELAQAYLALFLKLHLKMLPSEPVLLEEITNLSSQVEENWTHLQSLFNQSMCILNYLKSALL* ...
Specificity:Mouse polyclonal antibody raised against a partial recombinant WDR36.
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:The quality control of this antibody is limited to ELISA and Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig1:500-1:1000 for polysera
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:WDR36
Omim ID:137760, 609669,
see all human WDR36 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about