| CatalogCode: | H00131890-M02 |
| ProductName: | GRK7 Antibody |
| Product Description: | Mouse Monoclonal anti-GRK7 (4C4) |
| Clone: | 4C4 |
| Clonality: | Monoclonal |
| Immunogen: | GRK7 (NP_631948, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
| Epitope: | MVDMGALDNLIANTAYLQARKPSDCDSKELQRRRRSLALPGLQGCAELRQKLSLNFHSLCEQQPIGRRLFRDFLATVPTFRKAATFLEDVQNWELAEEGP ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. It is specifically expressed in the retina and the encoded protein has been shown to phosphorylate cone opsins and initiate their deactivation. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host_Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-GPRK7 antibody |
| ProteinTarget: | G protein-coupled receptor kinase 7 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 131890 |
| Gene_Symbol: | GRK7 |
| Omim_ID: | 606987, |
order or
more information: | company product webpage |
| request information: |
|