| CatalogCode: | H00117583-M01 |
| ProductName: | ALS2CR19 Antibody |
| Product Description: | Mouse Monoclonal anti-ALS2CR19 (8D7) |
| Clone: | 8D7 |
| Clonality: | Monoclonal |
| Immunogen: | ALS2CR19 (NP_689739, 101 a.a. ~ 210 a.a) partial recombinant protein with GST tag. |
| Epitope: | SPDAFETEVAAQLAAFKPIGGEIEVTPSALKLGTPLLVRRSSDPVPGPPADTQPSASHPGGQSLKLVVPDSTQNLEDREVLNGVQTELLTSPRTKDTLSDMTRTVEISG* ... |
| Specificity: | ALS2CR19 - amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 19 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-MGC16131 antibody, anti-PAR3B antibody, anti-PAR3L antibody, anti-PAR3LC antibody, anti-PAR3beta antibody, anti-Par3Lb antibody |
| ProteinTarget: | ALS2CR19 - amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 19 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 117583 |
| Gene_Symbol: | ALS2CR19 |
order or
more information: | company product webpage |
| request information: |
|