ExactAntigen

Mouse Monoclonal anti-C1orf19 (8C7)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00116461-M01
ProductName:C1orf19 Antibody
Product Description:Mouse Monoclonal anti-C1orf19 (8C7)
Clone:8C7
Clonality:Monoclonal
Immunogen:C1orf19 (NP_443197, 72 a.a. ~ 171 a.a) partial recombinant protein with GST tag.
Epitope:ESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLR* ...
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background:tRNA splicing is a fundamental process required for cell growth and division. SEN15 is a subunit of the tRNA splicing endonuclease, which catalyzes the removal of introns, the first step in tRNA splicing (Paushkin et al., 2004 [PubMed 15109492]).[supplied by OMIM]
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 Kappa
Host_Name:Mouse
Buffer:In 1x PBS, pH 7.2
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-sen15 antibody
ProteinTarget:chromosome 1 open reading frame 19
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:116461
Gene_Symbol:C1orf19
Omim_ID:608756,
see all human C1orf19 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about