| CatalogCode: | | H00116448-M05 |
| ProductName: | | OLIG1 Antibody |
| Product Description: | | Mouse Monoclonal anti-OLIG1 (3B3) |
| Clone: | | 3B3 |
| Clonality: | | Monoclonal |
| Immunogen: | | OLIG1 (NP_620450, 80 a.a. ~ 159 a.a) full length recombinant protein with GST tag. |
| Epitope: | | PDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRAL ... |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG2a Kappa |
| Host_Name: | | Mouse |
| Buffer: | | In 1x PBS, pH 7.2 |
| ListPrice: | | 295 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-BHLHB6 antibody |
| ProteinTarget: | | OLIG1 |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 116448 |
| Gene_Symbol: | | OLIG1 |
| Omim_ID: | | 606385, |
| more information: | | company product webpage |