ExactAntigen

CMTM5 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00116173-M02
Product Type:Primary Antibody
Product Name:CMTM5 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:116173
Host:Mouse
Clone:2B10
Isotype:IgG3 Lambda
Product Description:Mouse Monoclonal anti-CMTM5 (2B10)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = CMTM5 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-CKLFSF5 antibody, anti-FLJ37521 antibody
Immunogen:CMTM5 (AAH13109, 1 a.a. ~ 157 a.a) full length recombinant protein with GST tag.
Epitope:MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYMAAALLEFFITLAFLFLYATQYYQRFDRINWPCLDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ* ...
Specificity:CMTM5 - CKLF-like MARVEL transmembrane domain containing 5
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:CMTM5
Omim ID:607888,
see all human CMTM5 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about