| CatalogCode: | H00115426-M01 |
| ProductName: | UHRF2 Antibody |
| Product Description: | Mouse Monoclonal anti-UHRF2 (3A11) |
| Clone: | 3A11 |
| Clonality: | Monoclonal |
| Immunogen: | UHRF2 (NP_690856, 81 a.a. ~ 181 a.a) partial recombinant protein with GST tag. |
| Epitope: | PGTSTQIEAKPCSNSPPKVKKAPRVGPSNQPSTSARARLIDPGFGIYKVNELVDARDVGLGAWFEAHIHSVTRASDGQSRGKTPLKNGSSCKRTNGNIKH* ... |
| Specificity: | UHRF2 - ubiquitin-like, containing PHD and RING finger domains, 2 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-DKFZp434B0920 antibody, anti-DKFZp686G0837 antibody, anti-MGC33463 antibody, anti-NIRF antibody, anti-RNF107 antibody, anti-RP11-472F14.2 antibody, anti-URF2 antibody |
| ProteinTarget: | UHRF2 - ubiquitin-like, containing PHD and RING finger domains, 2 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 115426 |
| Gene_Symbol: | UHRF2 |
order or
more information: | company product webpage |
| request information: |
|