| CatalogCode: | H00113510-A01 |
| ProductName: | HEL308 Antibody |
| Product Description: | Mouse Polyclonal anti-HEL308 |
| Clonality: | Polyclonal |
| Immunogen: | HEL308 (NP_598375, 275 a.a. ~ 338 a.a) partial recombinant protein with GST tag. |
| Epitope: | GNAKAQTPIFSRSKQLKDTLLSEEINVAKKTIESSSNDLGPFYSLPSKVRDLYAQFKGIEKLY* ... |
| Specificity: | Mouse polyclonal antibody raised against a partial recombinant HEL308. |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:
1:500-1:1000 for polysera |
| Background: | HEL308 is a single-stranded DNA-dependent ATPase and DNA helicase (Marini and Wood, 2002 [PubMed 11751861]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-MGC20604 antibody |
| ProteinTarget: | HEL308 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 113510 |
| Gene_Symbol: | HEL308 |
| Omim_ID: | 606769, |
order or
more information: | company product webpage |
| request information: |
|