| CatalogCode: | H00093659-M01 |
| ProductName: | CGB5 Antibody |
| Product Description: | Mouse Monoclonal anti-CGB5 (3E4) |
| Clone: | 3E4 |
| Clonality: | Monoclonal |
| Immunogen: | CGB5 (NP_149032, 62 a.a. ~ 138 a.a) partial recombinant protein with GST tag. |
| Epitope: | TRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQD* ... |
| Specificity: | CGB5 - chorionic gonadotropin, beta polypeptide 5 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | This gene is a member of the glycoprotein hormone beta chain family and encodes the beta 5 subunit of chorionic gonadotropin (CG). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. CG is produced by the trophoblastic cells of the placenta and stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. The beta subunit of CG is encoded by 6 genes which are arranged in tandem and inverted pairs on chromosome 19q13.3 and contiguous with the luteinizing hormone beta subunit gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-HCG antibody |
| ProteinTarget: | CGB5 - chorionic gonadotropin, beta polypeptide 5 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 93659 |
| Gene_Symbol: | CGB5 |
| Omim_ID: | 608825, |
order or
more information: | company product webpage |
| request information: |
|