| CatalogCode: | | H00089790-A01 |
| ProductName: | | SIGLEC10 Antibody |
| Product Description: | | Mouse Polyclonal anti-SIGLEC10 |
| Clonality: | | Polyclonal |
| Immunogen: | | SIGLEC10 (NP_149121, 589 a.a. ~ 697 a.a) partial recombinant protein with GST tag. |
| Epitope: | | SRHSTILDYINVVPTAGPLAQKRNQKATPNSPRTPLPPGAPSPESKKNQKKQYQLPSFPEPKSSTQAPESQESQEELHYATLNFPGVRPRPEARMPKGTQADYAEVKF* ... |
| Specificity: | | SIGLEC10 - sialic acid binding Ig-like lectin 10 |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:
1:500-1:1000 for polysera |
| Background: | | SIGLECs are members of the immunoglobulin superfamily that are expressed on the cell surface. Most SIGLECs have 1 or more cytoplasmic immune receptor tyrosine-based inhibitory motifs, or ITIMs. SIGLECs are typically expressed on cells of the innate immune system, with the exception of the B-cell expressed SIGLEC6 (MIM 604405).[supplied by OMIM] |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-MGC126774 antibody, anti-PRO940 antibody, anti-SIGLEC-10 antibody, anti-SLG2 antibody |
| ProteinTarget: | | SIGLEC10 - sialic acid binding Ig-like lectin 10 |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 89790 |
| Gene_Symbol: | | SIGLEC10 |
| Omim_ID: | | 606091 H00089790-M01 |
| more information: | | company product webpage |