ExactAntigen

Mouse Monoclonal anti-PHF5A (2H7) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00084844-M01
ProductName: PHF5A Antibody
Product Description: Mouse Monoclonal anti-PHF5A (2H7)
Clone: 2H7
Clonality: Monoclonal
Immunogen: PHF5A (NP_116147, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag.
Epitope: MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR* ...
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background: This gene encodes a subunit of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. The protein encoded by this gene contains a PHD-finger-like domain that is flanked by highly basic N- and C-termini. This protein belongs to the PHD-finger superfamily and may act as a chromatin-associated protein. This gene has several pseudogenes on different chromosomes.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG2a Kappa
Host_Name: Mouse
Buffer: In 1x PBS, pH 7.2
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-INI antibody, anti-MGC1346 antibody, anti-SF3b14b antibody, anti-bK223H9.2 antibody
ProteinTarget: PHD finger protein 5A
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 84844
Gene_Symbol: PHF5A
more information: company product webpage
Also see:
see all human PHF5A antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about