| CatalogCode: | | H00084687-A01 |
| ProductName: | | PPP1R9B Antibody |
| Product Description: | | Mouse Polyclonal anti-PPP1R9B |
| Clonality: | | Polyclonal |
| Immunogen: | | PPP1R9B (NP_115984, 708 a.a. ~ 818 a.a) partial recombinant protein with GST tag. |
| Epitope: | | QLEQSVEENKERMEKLEGYWGEAQSLCQAVDEHLRETQAQYQALERKYSKAKRLIKDYQQKEIEFLKKETAQRRVLEESELARKEEMDKLLDKISELEGNLQTLRNSNST* ... |
| Specificity: | | PPP1R9B - protein phosphatase 1, regulatory subunit 9B, spinophilin |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | | Spinophilin is a regulatory subunit of protein phosphatase-1 catalytic subunit (PP1; see MIM 176875) and is highly enriched in dendritic spines, specialized protrusions from dendritic shafts that receive most of the excitatory input in the central nervous system (Allen et al., 1997 [PubMed 9275233]).[supplied by OMIM] |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-PPP1R6 antibody, anti-PPP1R9 antibody, anti-SPINO antibody |
| ProteinTarget: | | PPP1R9B - protein phosphatase 1, regulatory subunit 9B, spinophilin |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 84687 |
| Gene_Symbol: | | PPP1R9B |
| Omim_ID: | | 603325 NB100-844 |
| more information: | | company product webpage |