ExactAntigen

Mouse Monoclonal anti-MAP1LC3A (1D5)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00084557-M07
ProductName:MAP1LC3A Antibody
Product Description:Mouse Monoclonal anti-MAP1LC3A (1D5)
Clone:1D5
Clonality:Monoclonal
Immunogen:MAP1LC3A (NP_115903, 1 a.a. ~ 103 a.a) partial recombinant protein with GST tag.
Epitope:MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQE* ...
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against recombinant protein on ELISA.
Background:MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
Buffer:In 1x PBS, pH 7.2
ListPrice:295
AppSummary:ELISA
SpeciesSummary:Hu
ALTnames:anti-MAP1ALC3 antibody, anti-MAP1BLC3 antibody
ProteinTarget:microtubule-associated protein 1 light chain 3 alpha
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:84557
Gene_Symbol:MAP1LC3A
Omim_ID:601242,
see all human MAP1LC3A antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about