| CatalogCode: | H00084525-B01 |
| ProductName: | HOP Antibody |
| Product Description: | Mouse Polyclonal anti-HOP |
| Clonality: | Polyclonal |
| Immunogen: | HOP (AAH14225, 1 a.a. ~ 74 a.a) full-length human protein. |
| Epitope: | MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVID* ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggested that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants encoding the same protein have been observed, the full-length nature of only some has been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | WB, ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-Cameo antibody, anti-LAGY antibody, anti-MGC20820 antibody, anti-NECC1 antibody, anti-OB1 antibody, anti-SMAP31 antibody, anti-Toto antibody |
| ProteinTarget: | homeodomain-only protein |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene_Id: | 84525 |
| Gene_Symbol: | HOP |
| Omim_ID: | 607275, |
order or
more information: | company product webpage |
| request information: |
|