ExactAntigen

PPP1R1B Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00084152-M03
Product Type:Primary Antibody
Product Name:PPP1R1B Antibody
List Price:275
Clonality:Monoclonal
Gene ID:84152
Host:Mouse
Clone:3G11
Isotype:IgG2b Kappa
Product Description:Mouse Monoclonal anti-PPP1R1B (3G11)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:Midbrain dopaminergic neurons play a critical role in multiple brain functions, and abnormal signaling through dopaminergic pathways has been implicated in several major neurologic and psychiatric disorders. One well-studied target for the actions of dopa
Alternate Names:anti-DARPP-32 antibody, anti-DARPP32 antibody, anti-FLJ20940 antibody
Immunogen:PPP1R1B (AAH01519, 1 a.a. ~ 169 a.a) full length recombinant protein with GST tag.
Epitope:MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:PPP1R1B
Omim ID:604399,
see all human DARPP 32 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about