ExactAntigen

Mouse Monoclonal anti-C16orf9 (3D2) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00083986-M01
ProductName: C16orf9 Antibody
Product Description: Mouse Monoclonal anti-C16orf9 (3D2)
Clone: 3D2
Clonality: Monoclonal
Immunogen: C16orf9 (AAH13047, 1 a.a. ~ 553 a.a) full length recombinant protein with GST tag.
Epitope: MLDHKDLEAEIHPLKNEERKSQENLGNPSKNEDNVKSAPPQSRLSRCRAAAFFLSLFLCLFVVFVVSFVIPCPDRPASQRMWRIDYSAAVIYDFLAVDDINGDRIQDVLFLYKNTNSSNNFSRSCVDEGFSSPCTFAAAVSGANGSTLWERPVAQDVALVECAVPQPRGSEAPSACILVGRPSSFIAVNLFTGETLWNHSSSFSGNASILSPLLQVPDVDGDGAPDLLVLTQEREEVSGHLYSGSTGHQIGLRGS ...
Specificity: C16orf9 - chromosome 16 open reading frame 9
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG1 kappa
Host_Name: Mouse
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-DKFZP761D0211 antibody, anti-gene +108 antibody, anti-gs19 antibody
ProteinTarget: C16orf9 - chromosome 16 open reading frame 9
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 83986
Gene_Symbol: C16orf9
more information: company product webpage
Also see:
see all human ITFG3 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about