ExactAntigen

JAM3 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00083700-M01
Product Type:Primary Antibody
Product Name:JAM3 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:83700
Host:Mouse
Clone:1D3
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-JAM3 - junctional adhesion molecule 3 (1D3)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space.
Alternate Names:anti-FLJ14529 antibody, anti-JAM-C antibody, anti-JAMC antibody
Immunogen:JAM3 (NP_116190, 82 a.a. ~ 180 a.a) partial recombinant protein with GST tag.
Epitope:SNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELT* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is
Gene Symbol:JAM3
see all human JAM3 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about