| Catalog Code: | H00083700-M01 |
| Product Type: | Primary Antibody |
| Product Name: | JAM3 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 83700 |
| Host: | Mouse |
| Clone: | 1D3 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-JAM3 - junctional adhesion molecule 3 (1D3) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. |
| Alternate Names: | anti-FLJ14529 antibody, anti-JAM-C antibody, anti-JAMC antibody |
| Immunogen: | JAM3 (NP_116190, 82 a.a. ~ 180 a.a) partial recombinant protein with GST tag. |
| Epitope: | SNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELT* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is |
| Gene Symbol: | JAM3 |