| CatalogCode: | H00081607-M01 |
| ProductName: | PVRL4 Antibody |
| Product Description: | Mouse Monoclonal anti-PVRL4 (1D7) |
| Clone: | 1D7 |
| Clonality: | Monoclonal |
| Immunogen: | PVRL4 (NP_112178, 31 a.a. ~ 140 a.a) partial recombinant protein with GST tag. |
| Epitope: | AGELGTSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQA* ... |
| Specificity: | PVRL4 - poliovirus receptor-related 4 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | Poliovirus receptor-like proteins (PVRLs), such as PVRL4, are adhesion receptors of the immunoglobulin superfamily and function in cell-cell adhesion (Reymond et al., 2001 [PubMed 11544254]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgM Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-LNIR antibody, anti-PRR4 antibody, anti-nectin-4 antibody |
| ProteinTarget: | PVRL4 - poliovirus receptor-related 4 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 81607 |
| Gene_Symbol: | PVRL4 |
| Omim_ID: | 609607, |