ExactAntigen

TAIP-2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00080034-A01
Product Type:Primary Antibody
Product Name:TAIP-2 Antibody
List Price:205
Clonality:Polyclonal
Gene ID:80034
Host:Mouse
Product Description:Mouse Polyclonal anti-TAIP-2
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = 80034 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-FLJ11703 antibody
Immunogen:TAIP-2 (NP_079245, 476 a.a. ~ 586 a.a) partial recombinant protein with GST tag.
Epitope:QFVDYARQAEEAYGASHYPAANPSVIVCCSSSENDSGVPCNSLYPEHRSNHPQVEFHSYLKGPSQEGFVSALNGDSHISEHPAENSLSLAEKSILHEECIKSPVVETVPV* ...
Specificity:TAIP-2 - TGF-beta induced apotosis protein 2
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol. No preservative.
Package Size:50 ul
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:TAIP-2
see all human FAM130A2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about