ExactAntigen

Mouse Monoclonal anti-NPEPL1 (3F8-1A6) | Novus Biologicals antibody product information
CatalogCode:H00079716-M01
ProductName:NPEPL1 Antibody
Product Description:Mouse Monoclonal anti-NPEPL1 (3F8-1A6)
Clone:3F8-1A6
Clonality:Monoclonal
Immunogen:NPEPL1 (AAH20507, 1 a.a. ~ 524 a.a) full length recombinant protein with GST tag.
Epitope:MANVGLQFQASAGDSDPQSRPLLLLGQLHHLHRVPWSHVRGKLQPRVTEELWQAALSTLNPNPTDSCPLYLNYATVAALPCRVSRHNSPSAAHFITRLVRTCLPPGAHRCIVMVCEQPEVFASACALARAFPLFTHRSGASRRLEKKTVTVEFFLVGQDNGPVEVSTLQCLANATDGVRLAARIVDTPCNEMNTDTFLEEINKVGKELGIIPTIIRDEELKTRGFGGIYGVGKAALHPPALAVLSHTPDGATQTI ...
Specificity:NPEPL1 - aminopeptidase-like 1
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates and has been used in immunofluorescence.
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG3 kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, IF, WB
SpeciesSummary:Hu
ALTnames:anti-FLJ11583 antibody, anti-FLJ42065 antibody, anti-bA261P9.2 antibody
ProteinTarget:NPEPL1 - aminopeptidase-like 1
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:79716
Gene_Symbol:NPEPL1
order or
more information
:
company product webpage
request information:
Also see:
all human NPEPL1 antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about