| CatalogCode: | H00079036-A01 |
| ProductName: | MGC2749 Antibody |
| Product Description: | Mouse Polyclonal anti-MGC2749 |
| Clonality: | Polyclonal |
| Immunogen: | MGC2749 (NP_076974, 81 a.a. ~ 177 a.a) partial recombinant protein with GST tag. |
| Epitope: | FRRIRTLKGKLARQHPEAFSHIPEASFLEEEDEDPIPPSTTTTIATSEQSTGSCDTSPDTVSPSLSPGFEDLSHVQAGSPAINGRSQTDDEEMTGE* ... |
| Specificity: | MGC2749 - hypothetical protein MGC2749 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-MST096 antibody, anti-MSTP096 antibody |
| ProteinTarget: | MGC2749 - hypothetical protein MGC2749 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 79036 |
| Gene_Symbol: | MGC2749 |
order or
more information: | company product webpage |
| request information: |
|