ExactAntigen

Mouse Monoclonal anti-NADK (5F4)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00065220-M01
ProductName:NADK Antibody
Product Description:Mouse Monoclonal anti-NADK (5F4)
Clone:5F4
Clonality:Monoclonal
Immunogen:NADK (AAH01709, 1 a.a. ~ 447 a.a) full length recombinant protein with GST tag.
Epitope:MEMEQEKMTMNKELSPDAAAYCCSACHGDETWSYNHPIRGRAKSRSLSASPALGSTKEFRRTRSLHGPCPVTTFGPKACVLQNPQTIMHIQDPASQRLTWNKSPKSVLVIKKMRDASLLQPFKELCTHLMEENMIVYVEKKVLEDPAIASDESFGAVKKKFCTFREDYDDISNQIDFIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFSFENFQSQVTQVIEGNAAVVLRSRLKVRVVKELRGKKTAV ...
Specificity:NADK - NAD kinase
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background:NADK catalyzes the transfer of a phosphate group from ATP to NAD to generate NADP, which in its reduced form acts as an electron donor for biosynthetic reactions (Lerner et al., 2001 [PubMed 11594753]).[supplied by OMIM]
ProductRef:Pollak, N., et al. NAD kinase levels control the NADPH concentration in human cells. J Biol Chem. 2007 Sep 13; [Epub ahead of print].
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-FLJ13052 antibody, anti-RP1-283E3.6 antibody, anti-dJ283E3.1 antibody
ProteinTarget:NADK - NAD kinase
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:65220
Gene_Symbol:NADK
see all human NAD kinase antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about