| CatalogCode: | H00065057-M02 |
| ProductName: | ACD Antibody |
| Product Description: | Mouse Monoclonal anti-ACD (1D8-1B6) |
| Clone: | 1D8-1B6 |
| Clonality: | Monoclonal |
| Immunogen: | ACD (AAH16904, 1 a.a. ~ 545 a.a) full length recombinant protein with GST tag. |
| Epitope: | MPGRCQSDAAMRVNGPASRAPAGWTSGSLHTGPRAGRPRAQARGVRGRGLLLRPRPAKELPLPRKGGAWAPAGNPGPLHPLGVAVGMAGSGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEEHLSESTSSNAGLSLS ... |
| Specificity: | ACD - adrenocortical dysplasia homolog (mouse) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunofluorescence and immunohistochemistry on paraffin-embedded sections. |
| Background: | This gene encodes a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends. Through its interaction with other components, this protein plays a key role in the assembly and stabilization of this complex, and it mediates the access of telomerase to the telomere. Multiple transcript variants encoding different isoforms have been found for this gene. This gene, which is also referred to as TPP1, is distinct from the unrelated TPP1 gene on chromosome 11, which encodes tripeptidyl-peptidase I. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB, IHC-P, IF |
| SpeciesSummary: | Hu |
| ALTnames: | anti-24432 antibody, anti-PTOP antibody, anti-Pip1 antibody, anti-TINT1 antibody |
| ProteinTarget: | ACD - adrenocortical dysplasia homolog (mouse) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 65057 |
| Gene_Symbol: | ACD |
| Omim_ID: | 609377 H00065057-M01A |
order or
more information: | company product webpage |
| request information: |
|